EGFR pTyr1110 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
EGFR pTyr1110 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
EGFR pTyr1092 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Rat |
EGFR pTyr1172 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR pTyr1197 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR pTyr869 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR pTyr1110 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
HB EGF (HBEGF) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 67-96 amino acids from the Central region of Human HBEGF |
IL8 (CXCL8) mouse monoclonal antibody, clone I8-60, Biotin
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
IL8 (CXCL8) mouse monoclonal antibody, clone I8-60, HRP
Applications | ELISA |
Reactivities | Human |
Conjugation | HRP |
Rabbit polyclonal anti-EGFR antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EGFR. |
Rabbit polyclonal EGFR (Tyr869) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 869 (K-E-YP-H-A). |
Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Tyr1110) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1110 (P-V-YP-H-N). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-EGFR antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1189-1199 of human EGFR protein. |
Mouse Anti-Human IL-8 (1-77) (CXCL8) Purified (25 ug)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal EGFR (Ser1070) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human EGFR around the phosphorylation site of Sersine 1070. |
Modifications | Phospho-specific |
Biotinylated Anti-Human IL-8 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-8 (77 a.a.) (CXCL8) |
Biotinylated Anti-Human EGF Receptor Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CHO cells derived Recombinant Human EGF Receptor (EGFR) |
Anti-Human EGF Receptor Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CHO cells derived Recombinant Human EGF Receptor (EGFR) |
Biotinylated Anti-Human GRO/MGSA Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human GRO/MGSA (CXCL1) |
Biotinylated Anti-Human RANTES Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human RANTES (CCL5) |
Rabbit Polyclonal Anti-CXCL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCL1 antibody: synthetic peptide directed towards the middle region of human CXCL1. Synthetic peptide located within the following region: QSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
Rabbit Polyclonal Anti-EGFR Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | EGFR antibody was raised against synthetic 16 amino acid peptide from C-terminus of human EGFR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Marmoset, Rat (94%); Mouse (88%); Bovine, Dog, Hamster, Elephant, Horse (81%). |
Mouse monoclonal Anti-EGFR Clone EGFR1
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti EGFR Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Mouse anti EGFR Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti EGFR(pY1173) Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti EGFR(pS1070) Polyclonal Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit anti EGFR(pY1092) Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI1C8
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700470 |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI6E3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI3F2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI6F5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI9F12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI1A3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI3D7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI9G6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI4G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |