Antibodies

Jump to Filters
View as table Download
AMCase (CHIA) (N-term) Rabbit Polyclonal Antibody
AP50895PU-N

USD 450.00

2 Weeks

AMCase (CHIA) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 20-47 amino acids from the N-terminal region of human CHIA.
CHIT1 Rabbit Polyclonal Antibody
TA308046

USD 415.00

5 Days

Rabbit polyclonal antibody to Chitotriosidase (chitinase 1 (chitotriosidase))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 216 and 463 of Chitotriosidase (Uniprot ID#Q13231)
CHIT1 Goat Polyclonal Antibody
TA309549

USD 375.00

5 Days

Goat Polyclonal Antibody against CHIT1 (aa409-423)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EHGPSPGQDTFCQGK, from the internal region (near C Terminus) of the protein sequence according to NP_003456.1.
AMCase (CHIA) Rabbit Polyclonal Antibody
TA329462

USD 375.00

5 Days

Rabbit Polyclonal anti-CHIA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIA antibody: synthetic peptide directed towards the N terminal of human CHIA. Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
AMCase (CHIA) Rabbit Polyclonal Antibody
TA329463

USD 375.00

5 Days

Rabbit Polyclonal anti-CHIA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIA antibody: synthetic peptide directed towards the middle region of human CHIA. Synthetic peptide located within the following region: GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP
AMCase (CHIA) Mouse Monoclonal Antibody [Clone ID: OTI3H4]
CF811183

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CHIA mouse monoclonal antibody,clone OTI3H4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
AMCase (CHIA) Mouse Monoclonal Antibody [Clone ID: OTI3D8]
CF811213

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CHIA mouse monoclonal antibody,clone OTI3D8

Applications WB
Reactivities Human
Conjugation Unconjugated
AMCase (CHIA) Mouse Monoclonal Antibody [Clone ID: OTI3G3]
CF811224

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CHIA mouse monoclonal antibody,clone OTI3G3

Applications WB
Reactivities Human
Conjugation Unconjugated
AMCase (CHIA) Mouse Monoclonal Antibody [Clone ID: OTI1B8]
CF811227

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CHIA mouse monoclonal antibody,clone OTI1B8

Applications WB
Reactivities Human
Conjugation Unconjugated
AMCase (CHIA) Mouse Monoclonal Antibody [Clone ID: OTI3H4]
TA811183

USD 379.00

In Stock

CHIA mouse monoclonal antibody,clone OTI3H4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
AMCase (CHIA) Mouse Monoclonal Antibody [Clone ID: OTI3H4]
TA811183S

USD 159.00

2 Days

CHIA mouse monoclonal antibody,clone OTI3H4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

AMCase (CHIA) Mouse Monoclonal Antibody [Clone ID: OTI3D8]
TA811213

USD 379.00

In Stock

CHIA mouse monoclonal antibody,clone OTI3D8

Applications WB
Reactivities Human
Conjugation Unconjugated
AMCase (CHIA) Mouse Monoclonal Antibody [Clone ID: OTI1B8]
TA811227

USD 379.00

In Stock

CHIA mouse monoclonal antibody,clone OTI1B8

Applications WB
Reactivities Human
Conjugation Unconjugated