Rabbit anti-AMPH Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AMPH |
Rabbit anti-AMPH Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AMPH |
Rabbit polyclonal antibody to Amphiphysin (amphiphysin)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 194 of Amphiphysin (Uniprot ID#P49418) |
Rabbit polyclonal AMPH antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AMPH. |
Rabbit Polyclonal Amphiphysin Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
GSN Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human GSN |
Rabbit Polyclonal Anti-GSN Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN |
Goat Polyclonal Antibody against Amphiphysin / AMPH
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KRKDESRISKAE, from the internal region of the protein sequence according to NP_001626.1; NP_647477.1. |
Goat Polyclonal Antibody against GSN
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PRLKDKKMDAHP, from the internal region of the protein sequence according to NP_000168.1; NP_937895.1. |
Mouse Anti-Human CD16 Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-FCGR3 Clone DJ130c
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR3A mouse monoclonal antibody, clone OTI2A2
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR3A mouse monoclonal antibody, clone OTI12D8
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR3A mouse monoclonal antibody, clone OTI12H8
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-AMPH Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human amphiphysin |
Anti-AMPH Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human amphiphysin |
Anti-GSN Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin |
Anti-GSN Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin |
Rabbit Polyclonal Anti-FCGR3A Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FCGR3A |
AMPH Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AMPH |
FCGR3A mouse monoclonal antibody, clone OTI2A2
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
FCGR3A mouse monoclonal antibody, clone OTI2A2, Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
FCGR3A mouse monoclonal antibody, clone OTI2A2, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
FCGR3A mouse monoclonal antibody, clone OTI2A2
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FCGR3A mouse monoclonal antibody, clone OTI12D8
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
FCGR3A mouse monoclonal antibody, clone OTI12D8, Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
FCGR3A mouse monoclonal antibody, clone OTI12D8, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
FCGR3A mouse monoclonal antibody, clone OTI12D8
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FCGR3A mouse monoclonal antibody, clone OTI12H8
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
FCGR3A mouse monoclonal antibody, clone OTI12H8, Biotinylated
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
FCGR3A mouse monoclonal antibody, clone OTI12H8, HRP conjugated
Applications | FC |
Reactivities | Human |
Conjugation | HRP |
FCGR3A mouse monoclonal antibody, clone OTI12H8
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |