Antibodies

View as table Download

Rabbit Polyclonal MUC-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody

Applications IHC, WB
Reactivities Human, Amphibian, Bovine, Canine, Equine, Opossum
Conjugation Unconjugated
Immunogen A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody.

Mouse Monoclonal AG-2 Antibody (10E2)

Applications IHC, WB
Reactivities Human, Mouse, Bovine, Canine, Equine, Primate
Conjugation Unconjugated

Rabbit Polyclonal Gastrokine 1 Antibody

Applications WB
Reactivities Human, Equine, Porcine, Primate
Conjugation Unconjugated
Immunogen The portions of amino acids range between 100-150 of human GKN1 was used as the immunogen.