Antibodies

Jump to Filters
View as table Download
Pregnancy Specific Glycoprotein 1 (PSG1) Rabbit Polyclonal Antibody
TA346442

USD 410.00

5 Days

Rabbit Polyclonal Anti-PSG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSG1 antibody: synthetic peptide directed towards the N terminal of human PSG1. Synthetic peptide located within the following region: SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE
Pregnancy Specific Glycoprotein 1 (PSG1) Rabbit Polyclonal Antibody
TA346443

USD 410.00

5 Days

Rabbit Polyclonal Anti-PSG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSG1 antibody: synthetic peptide directed towards the C terminal of human PSG1. Synthetic peptide located within the following region: YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA