Germany
Japan
United Kingdom
China
USD 524.00
In Stock
Antibodies
View as table Download
Prion protein PrP (PRNP) mouse monoclonal antibody, clone EM-20, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal STIP1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-297 amino acids from the Central region of human STIP1. |
Rabbit Polyclonal Prion protein Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal STIP1 Antibody (C-term)
| Applications | FC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 461-488 amino acids from the C-terminal region of human STIP1. |
Rabbit Polyclonal Anti-STIP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STIP1 antibody: synthetic peptide directed towards the C terminal of human STIP1. Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS |
Goat Polyclonal Antibody against Prion Protein (143-153)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SDYEDRYYREN, from the internal region of the protein sequence according to NP_000302.1; NP_898902.1. |
Rabbit Polyclonal Prion protein Antibody
| Applications | WB |
| Reactivities | Bovine, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 142-148 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Prion protein Antibody
| Applications | WB |
| Reactivities | Bovine, Sheep, Avian |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 162-170 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Prion protein Antibody
| Applications | WB |
| Reactivities | Bovine, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 217-229 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Anti-STIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STIP1 antibody: synthetic peptide directed towards the N terminal of human STIP1. Synthetic peptide located within the following region: ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM |
Rabbit Polyclonal Anti-PRNP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Prnp antibody is: synthetic peptide directed towards the middle region of Mouse Prnp. Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF |
Active filters
Families
- Stem cell - Pluripotency
Pathways
- Prion diseases