Rabbit Polyclonal FKBP3 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FKBP3 antibody: mouse FKBP3 (FK506 Binding Protein 3), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein |
Rabbit Polyclonal Anti-FKBP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FKBP3 antibody: synthetic peptide directed towards the C terminal of human FKBP3. Synthetic peptide located within the following region: EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID |
Germany
Japan
United Kingdom
China
