Antibodies

Jump to Filters
View as table Download
C1orf103 (LRIF1) Rabbit Polyclonal Antibody
TA335519

USD 375.00

5 Days

Rabbit Polyclonal Anti-C1orf103 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C1orf103 Antibody: synthetic peptide directed towards the middle region of human C1orf103. Synthetic peptide located within the following region: SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVT
C1orf103 (LRIF1) Rabbit Polyclonal Antibody
TA336159

USD 375.00

5 Days

Rabbit Polyclonal Anti-C1orf103 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C1orf103 Antibody: synthetic peptide directed towards the N terminal of human C1orf103. Synthetic peptide located within the following region: KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE