Rabbit Polyclonal Anti-SIRT4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRT4 antibody: synthetic peptide directed towards the middle region of human SIRT4. Synthetic peptide located within the following region: QVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQV |
Goat Polyclonal Antibody against SIRT4
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SRCGELLPLIDPC, from the C Terminus of the protein sequence according to NP_036372.1. |
Rabbit polyclonal anti-SIRT4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 72 of rat SIRT4 |
Rabbit Polyclonal Anti-SIRT4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRT4 antibody: synthetic peptide directed towards the N terminal of human SIRT4. Synthetic peptide located within the following region: ASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYAR |
Rabbit Polyclonal Anti-SIRT4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SIRT4 |
Germany
Japan
United Kingdom
China
