Antibodies

Jump to Filters
View as table Download
ZFP37 Rabbit Polyclonal Antibody
TA344475

USD 475.00

5 Days

Rabbit Polyclonal Anti-Zfp566 Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Zfp566 antibody: synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI. Synthetic peptide located within the following region: YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQR
ZFP37 Rabbit Polyclonal Antibody
TA334008

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZFP37 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZFP37 Antibody: synthetic peptide directed towards the middle region of human ZFP37. Synthetic peptide located within the following region: LCCHSSSHIKQDKIQTGEKHEKSPSLSSSTKHEKPQACVKPYECNQCGKV