Rabbit polyclonal anti-ZNF148 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZNF148. |
Rabbit polyclonal anti-ZNF148 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZNF148. |
Rabbit Polyclonal Anti-ZNF148 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZNF148 Antibody: A synthesized peptide derived from human ZNF148 |
Rabbit Polyclonal Anti-ZNF148 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZNF148 antibody: synthetic peptide directed towards the middle region of human ZNF148. Synthetic peptide located within the following region: RCAIKGGLLTSEEDSGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKS |
Rabbit Polyclonal Anti-ZNF148 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ZNF148 Antibody: synthetic peptide directed towards the middle region of human ZNF148. Synthetic peptide located within the following region: QHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPF |