USD 475.00
5 Days
Rabbit Polyclonal Anti-DEAF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DEAF1 antibody: synthetic peptide directed towards the N terminal of human DEAF1. Synthetic peptide located within the following region: EEPVLSRDEDSEEDADSEAERETPRVTAVAVMAAEPGHMDMGAEALPGPD |
USD 475.00
5 Days
Rabbit Polyclonal Anti-DEAF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DEAF1 antibody: synthetic peptide directed towards the C terminal of human DEAF1. Synthetic peptide located within the following region: TGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVTV |
USD 450.00
2 Weeks
Deformed Epidermal Autoregulatory Factor 1 (DEAF1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 473-502 amino acids from the C-terminal region of human DEAF1 |
USD 345.00
In Stock
Germany
Japan
United Kingdom
China
