Antibodies

Jump to Filters
View as table Download
ZNF148 Rabbit Polyclonal Antibody
TA314693

USD 345.00

In Stock

Rabbit polyclonal anti-ZNF148 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZNF148.
ZNF148 Rabbit Polyclonal Antibody
TA347789

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ZNF148 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF148 Antibody: A synthesized peptide derived from human ZNF148
ZNF148 Rabbit Polyclonal Antibody
TA337247

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF148 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF148 antibody: synthetic peptide directed towards the middle region of human ZNF148. Synthetic peptide located within the following region: RCAIKGGLLTSEEDSGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKS
ZNF148 Rabbit Polyclonal Antibody
TA335485

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF148 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF148 Antibody: synthetic peptide directed towards the middle region of human ZNF148. Synthetic peptide located within the following region: QHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPF