Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 42 of 42 results

(reset)

ZFP38 (ZSCAN21) Rabbit Polyclonal Antibody

TA345531

USD 410.00

5 Days

Rabbit Polyclonal Anti-ZSCAN21 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ZSCAN21 antibody: synthetic peptide directed towards the C terminal of human ZSCAN21. Synthetic peptide located within the following region: AFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP

ZFP38 (ZSCAN21) Rabbit Polyclonal Antibody

TA342490

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZSCAN21 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ZSCAN21 antibody is: synthetic peptide directed towards the middle region of Human ZSCAN21. Synthetic peptide located within the following region: EALSQLRVLCCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCP

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2H8]

CF506092

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZSCAN21 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)

Applications	WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2E3]

CF506093

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZSCAN21 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications	WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2E5]

CF506118

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZSCAN21 mouse monoclonal antibody,clone OTI2E5

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2F5]

CF506146

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZSCAN21 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications	WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

CF506147

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ZSCAN21 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI3B3]

CF506148

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZSCAN21 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications	WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2D8]

CF506149

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZSCAN21 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI1H7]

CF506150

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZSCAN21 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)

Applications	WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2H8]

TA506092

USD 379.00

In Stock

ZSCAN21 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)

Applications	WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H8]

TA506092AM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 2H8, Biotinylated

Applications	WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H8]

TA506092BM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 2H8, HRP conjugated

Applications	WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2H8]

TA506092S

USD 159.00

2 Days

ZSCAN21 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)

Applications	WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2E3]

TA506093

USD 379.00

In Stock

ZSCAN21 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications	WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E3]

TA506093AM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 2E3, Biotinylated

Applications	WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E3]

TA506093BM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 2E3, HRP conjugated

Applications	WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2E3]

TA506093S

USD 159.00

2 Days

ZSCAN21 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications	WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2E5]

TA506118

USD 379.00

In Stock

ZSCAN21 mouse monoclonal antibody,clone OTI2E5

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E5]

TA506118AM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 2E5, Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E5]

TA506118BM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 2E5, HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2E5]

TA506118S

USD 159.00

2 Days

ZSCAN21 mouse monoclonal antibody,clone OTI2E5

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2F5]

TA506146

USD 379.00

In Stock

ZSCAN21 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications	WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F5]

TA506146AM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 2F5, Biotinylated

Applications	WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]

TA506146BM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 2F5, HRP conjugated

Applications	WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2F5]

TA506146S

USD 159.00

In Stock

ZSCAN21 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications	WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

TA506147

USD 379.00

In Stock

ZSCAN21 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D4]

TA506147AM

USD 420.00

4 Weeks

ZSCAN21 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), Biotinylated

Applications	IF, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D4]

TA506147BM

USD 420.00

4 Weeks

ZSCAN21 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), HRP conjugated

Applications	IF, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

TA506147S

USD 159.00

2 Days

ZSCAN21 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI3B3]

TA506148

USD 379.00

In Stock

ZSCAN21 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications	WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]

TA506148AM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 3B3, Biotinylated

Applications	WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B3]

TA506148BM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 3B3, HRP conjugated

Applications	WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI3B3]

TA506148S

USD 159.00

2 Days

ZSCAN21 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications	WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2D8]

TA506149

USD 379.00

In Stock

ZSCAN21 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D8]

TA506149AM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 2D8, Biotinylated

Applications	WB
Reactivities	Human
Conjugation	Biotin

• 

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D8]

TA506149BM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 2D8, HRP conjugated

Applications	WB
Reactivities	Human
Conjugation	HRP

• 

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI2D8]

TA506149S

USD 159.00

2 Days

ZSCAN21 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI1H7]

TA506150

USD 379.00

In Stock

ZSCAN21 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)

Applications	WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H7]

TA506150AM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 1H7, Biotinylated

Applications	WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H7]

TA506150BM

USD 420.00

5 Days

ZSCAN21 mouse monoclonal antibody,clone 1H7, HRP conjugated

Applications	WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody [Clone ID: OTI1H7]

TA506150S

USD 159.00

2 Days

ZSCAN21 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)

Applications	WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

1 - 42 of 42 results