ZFP38 (ZSCAN21) Rabbit Polyclonal Antibody

CAT#: TA345531

Rabbit Polyclonal Anti-ZSCAN21 Antibody

Product Images

WB Suggested Anti-ZSCAN21 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 62500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZSCAN21 antibody: synthetic peptide directed towards the C terminal of human ZSCAN21. Synthetic peptide located within the following region: AFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: zinc finger and SCAN domain containing 21
• Database Link:
  NP_666019
  Entrez Gene 7589 Human
  UniProt ID Q9Y5A6
• Background: ZSCAN21 belongs to the krueppel C2H2-type zinc-finger protein family and is a strong transcriptional activator.
• Synonyms: NY-REN-21; Zipro1; ZNF38
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 92%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors