Rabbit Polyclonal Anti-Ring1A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ring1A Antibody: Peptide sequence around aa.35~39( I-A-V-S-P) derived from Human Ring1A. |
Rabbit Polyclonal Anti-Ring1A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ring1A Antibody: Peptide sequence around aa.35~39( I-A-V-S-P) derived from Human Ring1A. |
Anti-RING1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.35~39( I-A-V-S-P) derived from Human Ring1A. |
Rabbit Polyclonal Anti-RING1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the middle region of human RING1. Synthetic peptide located within the following region: TGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIEL |
Rabbit Polyclonal Anti-RING1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the middle region of human RING1. Synthetic peptide located within the following region: APSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLAL |
Rabbit Polyclonal Anti-RING1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the N terminal of human RING1. Synthetic peptide located within the following region: MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPI |
Rabbit Polyclonal Anti-RING1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the middle region of human RING1. Synthetic peptide located within the following region: SDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFT |
Carrier-free (BSA/glycerol-free) RING1 mouse monoclonal antibody,clone OTI2D11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RING1 mouse monoclonal antibody,clone OTI6F11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RING1 mouse monoclonal antibody,clone OTI11G7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RING1 mouse monoclonal antibody,clone OTI3G7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RING1 mouse monoclonal antibody,clone OTI2D11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RING1 mouse monoclonal antibody,clone OTI2D11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RING1 mouse monoclonal antibody,clone OTI2D11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RING1 mouse monoclonal antibody,clone OTI2D11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RING1 mouse monoclonal antibody,clone OTI6F11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RING1 mouse monoclonal antibody,clone OTI6F11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RING1 mouse monoclonal antibody,clone OTI6F11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RING1 mouse monoclonal antibody,clone OTI6F11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RING1 mouse monoclonal antibody,clone OTI11G7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RING1 mouse monoclonal antibody,clone OTI11G7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RING1 mouse monoclonal antibody,clone OTI11G7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RING1 mouse monoclonal antibody,clone OTI11G7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RING1 mouse monoclonal antibody,clone OTI3G7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RING1 mouse monoclonal antibody,clone OTI3G7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RING1 mouse monoclonal antibody,clone OTI3G7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RING1 mouse monoclonal antibody,clone OTI3G7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |