Antibodies

View as table Download

DLX2 mouse monoclonal antibody, clone 2B12, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse

DLX2 mouse monoclonal antibody, clone 2C8, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse

DLX2 mouse monoclonal antibody, clone 2E12, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse

Rabbit Polyclonal anti-DLX2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX2 antibody: synthetic peptide directed towards the N terminal of human DLX2. Synthetic peptide located within the following region: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKP

Rabbit Polyclonal Anti-DLX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX2 antibody: synthetic peptide directed towards the C terminal of human DLX2. Synthetic peptide located within the following region: PASWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTS

DLX2 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human DLX2