Antibodies

View as table Download

Rabbit anti-GTF2F2 Polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human GTF2F2

Rabbit Polyclonal anti-GTF2F2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the C terminal of human GTF2F2. Synthetic peptide located within the following region: KDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD

Rabbit Polyclonal anti-GTF2F2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2. Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ

Rabbit Polyclonal anti-GTF2F2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2. Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ