Antibodies

View as table Download

Rabbit polyclonal anti-ZNF148 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZNF148.

Rabbit Polyclonal Anti-ZNF148 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF148 Antibody: A synthesized peptide derived from human ZNF148

ZNF148 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ZNF148 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF148 antibody: synthetic peptide directed towards the middle region of human ZNF148. Synthetic peptide located within the following region: RCAIKGGLLTSEEDSGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKS

Rabbit Polyclonal Anti-ZNF148 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF148 Antibody: synthetic peptide directed towards the middle region of human ZNF148. Synthetic peptide located within the following region: QHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPF