Antibodies

View as table Download

Rabbit Polyclonal ATG9A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG9A antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human ATG9A.

Rabbit polyclonal ATG9A Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATG9A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 717-746 amino acids from the C-terminal region of human ATG9A.

Rabbit Polyclonal Anti-ATG9A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG9A Antibody: synthetic peptide directed towards the middle region of human ATG9A. Synthetic peptide located within the following region: VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV

Rabbit Polyclonal Anti-ATG9A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ATG9A