Antibodies

Jump to Filters
View as table Download
METTL7A Rabbit Polyclonal Antibody
TA346478

USD 410.00

2 Weeks

Rabbit Polyclonal Anti-METTL7A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METTL7A antibody: synthetic peptide directed towards the N terminal of human METTL7A. Synthetic peptide located within the following region: MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN
METTL7A Rabbit Polyclonal Antibody
TA306679

USD 430.00

5 Days

Rabbit Polyclonal MettL7A Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MettL7A antibody was raised against a 13 amino acid peptide near the center of human MettL7A.
METTL7A Rabbit Polyclonal Antibody
TA306674

USD 430.00

5 Days

Rabbit Polyclonal MettL7A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MettL7A antibody was raised against a 12 amino acid peptide near the carboxy terminus of human MettL7A.