Rabbit Polyclonal Anti-PCDHA6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCDHA6 antibody is: synthetic peptide directed towards the N-terminal region of Human PCDHA6. Synthetic peptide located within the following region: LAAWKVGSGQLHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRMASKD |
Rabbit Polyclonal Anti-PCDHA6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCDHA6 antibody: synthetic peptide directed towards the C terminal of human PCDHA6. Synthetic peptide located within the following region: LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY |
Rabbit Polyclonal Anti-PCDHA6 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PCDHA6 |
Germany
Japan
United Kingdom
China