Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-C10orf54 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C10orf54 antibody: synthetic peptide directed towards the N terminal of human C10orf54. Synthetic peptide located within the following region: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE |
Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI6E5
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI8B8
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
C10orf54 mouse monoclonal antibody,clone OTI6E5
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
C10orf54 mouse monoclonal antibody,clone OTI6E5, Biotinylated
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
C10orf54 mouse monoclonal antibody,clone OTI6E5, HRP conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | HRP |
C10orf54 mouse monoclonal antibody,clone OTI6E5
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
C10orf54 mouse monoclonal antibody,clone OTI8B8
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
C10orf54 mouse monoclonal antibody,clone OTI8B8, Biotinylated
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
C10orf54 mouse monoclonal antibody,clone OTI8B8, HRP conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | HRP |
C10orf54 mouse monoclonal antibody,clone OTI8B8
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- VSIR
Families
- Transmembrane