Antibodies

View as table Download

Goat Polyclonal Anti-CB1 (isoform a) Antibody

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-CB1 (isoform a) Antibody: Peptide with sequence SNDIQYEDIKGDMAS-C, from the N Terminus of the protein sequence according to NP_057167.2.

Rabbit anti-CNR1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Recombinant protein of human CNR1

Goat Polyclonal Antibody against Cannabinoid Receptor 1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HTSEDGKVQVTRPDQ, from the internal region of the protein sequence according to NP_057167.2; NP_149421.1.

Rabbit Polyclonal Anti-CNR1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen CNR1 / CB1 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CNR1 / CB1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Mouse, Rat, Hamster, Panda, Dog, Bat, Cat, Horse (100%); Marmoset, Pig, Turkey, Zebra finch, Chicken (95%); Opossum, Platypus (90%); Bovine, Lizard (85%).

Rabbit Polyclonal Anti-CNR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNR1 antibody: synthetic peptide directed towards the N terminal of human CNR1. Synthetic peptide located within the following region: ADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVL