Rabbit Polyclonal ORAI2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ORAI2 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human ORAI2. |
Rabbit Polyclonal ORAI2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ORAI2 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human ORAI2. |
Rabbit Polyclonal Anti-ORAI2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ORAI2 antibody: synthetic peptide directed towards the middle region of human ORAI2. Synthetic peptide located within the following region: IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ |
Carrier-free (BSA/glycerol-free) ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |