Antibodies

View as table Download

Rabbit Polyclonal Anti-FAP-1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-FAP-1 Antibody: A synthesized peptide derived from human FAP-1

Rabbit Polyclonal Anti-FAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAP antibody is: synthetic peptide directed towards the C-terminal region of Human FAP. Synthetic peptide located within the following region: SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA

Rabbit Polyclonal Anti-FAP Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Immunogen FAP Alpha antibody was raised against synthetic 17 amino acid peptide from extracellular domain of human FAP. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Horse (100%); Panda, Bovine, Pig (94%); Elephant, Dog (88%); Rat, Bat, Platypus (82%).

Rabbit Polyclonal Anti-FAP Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FAP