Antibodies

View as table Download

Rabbit Polyclonal ORAI2 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ORAI2 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human ORAI2.

Rabbit Polyclonal Anti-ORAI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ORAI2 antibody: synthetic peptide directed towards the middle region of human ORAI2. Synthetic peptide located within the following region: IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ

Carrier-free (BSA/glycerol-free) ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated