Mouse Monoclonal Syntenin Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Syntenin Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-SDCBP Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SDCBP |
Rabbit Polyclonal Anti-SDCBP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SDCBP Antibody: synthetic peptide directed towards the middle region of human SDCBP. Synthetic peptide located within the following region: VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV |
Goat Polyclonal Antibody against SDCBP
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SLEDLKVDKVIQAQ-C, from the N Terminus of the protein sequence according to NP_005616.2; NP_001007068.1; NP_001007069; NP_001007070.1; NP_001007071.1. |
Rabbit Polyclonal Anti-SDCBP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SDCBP Antibody: synthetic peptide directed towards the middle region of human SDCBP. Synthetic peptide located within the following region: NSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDR |
Rabbit Polyclonal Anti-SDCBP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SDCBP Antibody: synthetic peptide directed towards the middle region of human SDCBP. Synthetic peptide located within the following region: NGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTV |
Carrier-free (BSA/glycerol-free) SDCBP mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SDCBP Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SDCBP |
Rabbit Polyclonal Anti-SDCBP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
SDCBP (Syntenin) mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
SDCBP mouse monoclonal antibody,clone 2H6, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
SDCBP mouse monoclonal antibody,clone 2H6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SDCBP (Syntenin) mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SDCBP mouse monoclonal antibody,clone UMAB69
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SDCBP mouse monoclonal antibody,clone UMAB69
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SDCBP mouse monoclonal antibody,clone UMAB69
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |