Antibodies

View as table Download

Sphingomyelin Synthase 1 (SGMS1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide derived from the Human Sphingomyelin Synthase 1 protein

Sphingomyelin Synthase 1 (SGMS1) rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide derived from the mouse sphingomyelin synthase 1 protein

Rabbit polyclonal Anti-SGMS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGMS1 antibody: synthetic peptide directed towards the middle region of human SGMS1. Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI