Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Rabbit Polyclonal Anti-ACTIN Antibody
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of Arabidopsis thaliana actin |
Rabbit Polyclonal Anti-Actin-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan |
Rabbit Polyclonal Anti-Beta actin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Beta actin antibody: A synthesized peptide derived from human Beta actin |
Rabbit Polyclonal Anti-beta-Actin Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Biotin-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin. |
Rabbit Polyclonal Anti-beta-Actin Antibody (HRP)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | HRP-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin. |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7]
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7] (biotin)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ACTB
Isotypes
- IgG
Pathways
- Dilated cardiomyopathy