Antibodies

View as table Download

Rabbit anti-SOD1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOD1

Rabbit Polyclonal Anti-SOD1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SOD1. Synthetic peptide located within the following region: DVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA

Anti-SOD1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-159 amino acids of human superoxide dismutase 1, soluble

Rabbit Polyclonal Anti-SOD1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 Antibody: Synthetic peptide from SOD1

Rabbit Polyclonal Anti-SOD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Goat Polyclonal Antibody against SOD1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRKHGGPKDEERH, from the internal region of the protein sequence according to NP_000445.1.