Rabbit Polyclonal Anti-SETD7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SETD7 antibody: synthetic peptide directed towards the C terminal of human SETD7. Synthetic peptide located within the following region: PRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF |
Rabbit Polyclonal Set9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Set9 antibody: human Set9 (SET domain containing (lysine methyltransferase) 9), using a recombinant protein. |
Rabbit Polyclonal Set9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Set9 antibody: human Set9 (SET domain containing (lysine methyltransferase) 9), using a recombinant protein. |
Rabbit Polyclonal Anti-SETD7 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SETD7 |
Germany
Japan
United Kingdom
China