Antibodies

Jump to Filters
View as table Download
TRAIL (TNFSF10) Rabbit Polyclonal Antibody
TA347955

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CD253 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD253 Antibody: A synthesized peptide derived from human CD253
TRAIL (TNFSF10) Rabbit Polyclonal Antibody
TA305942

USD 430.00

5 Days

Rabbit Polyclonal Trail Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRAIL antibody was raised against a peptide corresponding to 17 amino acids near the carboxy terminus of human TRAIL. The immunogen is located within the last 50 amino acids of Trail.
TRAIL (TNFSF10) Rabbit Polyclonal Antibody
TA312997

USD 345.00

In Stock

Rabbit polyclonal anti-CD253 / TNFSF10 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CD253.
TRAIL (TNFSF10) Rabbit Polyclonal Antibody
TA354552

USD 330.00

5 Days

Rabbit anti CD253/TRAIL/ (TNFSF10) (IN1) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of TRAIL protein (from 115aa-140aa). This sequence is identical to human and mouse.
TRAIL (TNFSF10) Rabbit Polyclonal Antibody
TA328462

USD 285.00

5 Days

Anti-Human sTRAIL/Apo2L Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTRAIL/Apo2L
TRAIL (TNFSF10) Rabbit Polyclonal Antibody
TA330336

USD 375.00

5 Days

Rabbit Polyclonal Anti-TNFSF10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF10 antibody: synthetic peptide directed towards the N terminal of human TNFSF10. Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE
TRAIL (TNFSF10) Rabbit Polyclonal Antibody
TA354553

USD 330.00

5 Days

Rabbit anti CD253/TRAIL (IN2) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence of human TRAIL protein (from 160aa-190aa). This sequence is has one amino acid difference from rat origin.
TRAIL (TNFSF10) Rabbit Polyclonal Antibody
TA354554

USD 330.00

5 Days

Rabbit anti CD253/TRAIL (CT) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of TRAIL protein (from 230aa-280aa). This sequence is identical to human, rat and mouse.