Antibodies

View as table Download

Rabbit Polyclonal Anti-APLNR Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human APLNR

Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a region within amino acids 2 and 96 of Apelin Receptor (Uniprot ID#P35414)

Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 284 and 376 of Apelin Receptor (Uniprot ID#P35414)

Rabbit polyclonal anti-AGTRL1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AGTRL1.

Rabbit Polyclonal Anti-APLNR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APLNR antibody: synthetic peptide directed towards the N terminal of human APLNR. Synthetic peptide located within the following region: NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW

Anti-APLNR Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 272-380 amino acids of human apelin receptor