Rabbit anti-TRADD Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TRADD |
Rabbit anti-TRADD Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TRADD |
Rabbit polyclonal anti-TRADD antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TRADD. |
Rabbit Polyclonal Anti-TRADD Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRADD Antibody: A synthesized peptide derived from human TRADD |
Rabbit Polyclonal antibody to TRADD (TNFRSF1A-associated via death domain)
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 43 of TRADD (Uniprot ID#Q15628) |
Rabbit Polyclonal Anti-TRADD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRADD antibody: synthetic peptide directed towards the middle region of human TRADD. Synthetic peptide located within the following region: YEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGL |