Antibodies

View as table Download

Rabbit Polyclonal AIMP2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen AIMP2 antibody was raised against a 16 amino acid peptide near the center of human AIMP2.

Rabbit Polyclonal Anti-AIMP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIMP2 antibody: synthetic peptide directed towards the middle region of human AIMP2. Synthetic peptide located within the following region: TVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS

Rabbit Polyclonal Anti-AIMP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIMP2 antibody: synthetic peptide directed towards the N terminal of human AIMP2. Synthetic peptide located within the following region: SLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTT

Anti-AIMP2 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 11-200 of Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2

Anti-AIMP2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 11-200 of Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2

Rabbit Polyclonal Anti-AIMP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human AIMP2