Rabbit Polyclonal AIMP2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | AIMP2 antibody was raised against a 16 amino acid peptide near the center of human AIMP2. |
Rabbit Polyclonal AIMP2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | AIMP2 antibody was raised against a 16 amino acid peptide near the center of human AIMP2. |
Rabbit Polyclonal Anti-AIMP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AIMP2 antibody: synthetic peptide directed towards the middle region of human AIMP2. Synthetic peptide located within the following region: TVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS |
Rabbit Polyclonal Anti-AIMP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AIMP2 antibody: synthetic peptide directed towards the N terminal of human AIMP2. Synthetic peptide located within the following region: SLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTT |
Anti-AIMP2 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 11-200 of Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 |
Anti-AIMP2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 11-200 of Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 |
Rabbit Polyclonal Anti-AIMP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AIMP2 |