Rabbit monoclonal antibody against c-Rel(clone EPR2558)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against c-Rel(clone EPR2558)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Rel Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Rel |
Rabbit Polyclonal Rel (Ser503) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Rel around the phosphorylation site of Serine 503 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-REL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-REL antibody: synthetic peptide directed towards the N terminal of human REL. Synthetic peptide located within the following region: ASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQ |
Phospho-REL-S503 Rabbit Polyclonal Antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S503 of human REL |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-REL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-REL Antibody: synthetic peptide directed towards the middle region of human REL. Synthetic peptide located within the following region: CADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQ |
Rabbit Polyclonal Anti-Rel Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rel antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF |
Rabbit anti Rel (pS503) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -CSVNMMTTS-S-DSMGETD- with phosphorylation sites at Ser503 of c-Rel protein from human. |
Rabbit Polyclonal Anti-REL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human REL |
REL rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human REL |
REL Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human REL (NP_002899.1). |
Modifications | Unmodified |
c-Rel Rabbit polyclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human c-Rel |