Antibodies

Jump to Filters
View as table Download
SLAMF1 Rabbit Polyclonal Antibody
TA319706

USD 430.00

5 Days

Rabbit Polyclonal SLAMF1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SLAMF1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human SLAMF1.
SLAMF1 Rabbit Polyclonal Antibody
TA343233

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLAMF1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Slamf1 antibody is: synthetic peptide directed towards the middle region of Mouse Slamf1. Synthetic peptide located within the following region: QVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSR
SLAMF1 Rabbit Polyclonal Antibody
TA381530

USD 220.00

3 Weeks

SLAMF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-237 of human SLAMF1 (NP_003028.1).
Modifications Unmodified