Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 46 and 344 of ALPPL2 (Uniprot ID#P10696) |
Rabbit Polyclonal anti-ALPPL2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the N terminal of human ALPPL2. Synthetic peptide located within the following region: MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT |
Rabbit Polyclonal anti-ALPPL2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the middle region of human ALPPL2. Synthetic peptide located within the following region: SESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV |
Anti-ALPPL2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 420-434 amino acids of human alkaline phosphatase, placental-like 2 |
Germany
Japan
United Kingdom
China
