Antibodies

View as table Download

Rabbit Polyclonal EF2C1/2 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EF2C1/2 antibody: human IEF2C1/2 (eukaryotic translation initiation factor 2C1 and 2), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of both EIF2C1 and EIF2C2.

Goat Anti-EIF2C1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KNASYNLDPYIQEF, from the internal region of the protein sequence according to NP_036331.1.

Rabbit Polyclonal Anti-AGO1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGO1 antibody: synthetic peptide directed towards the N terminal of human AGO1. Synthetic peptide located within the following region: MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI

Rabbit Polyclonal Anti-AGO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human AGO1

AGO1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human AGO1

AGO1 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human AGO1 (NP_036331.1).
Modifications Unmodified