Rabbit Polyclonal Anti-APOBEC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOBEC1 antibody: synthetic peptide directed towards the N terminal of human APOBEC1. Synthetic peptide located within the following region: TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW |
Goat Anti-APOBEC1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DVFYDPRELRKEAC, from the internal region (near N Terminus) of the protein sequence according to NP_001635.2. |
APOBEC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human APOBEC1 (NP_001291495). |
Germany
Japan
United Kingdom
China
