Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-E2F4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F4 Antibody: A synthesized peptide derived from human E2F4 |
Antibodies
View as table Download
Rabbit Polyclonal anti-E2F4 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F4 antibody: synthetic peptide directed towards the C terminal of human E2F4. Synthetic peptide located within the following region: SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL |
Rabbit Polyclonal Anti-E2F4 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human E2F4 |
E2F4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human E2F4. |
| Modifications | Unmodified |
E2F4 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human E2F4 |
Active filters
Target Symbol
- E2F4
Isotypes
- IgG