EIF3B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EIF3B |
EIF3B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EIF3B |
Rabbit Polyclonal Anti-EIF3S9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EIF3S9 antibody: synthetic peptide directed towards the C terminal of human EIF3S9. Synthetic peptide located within the following region: YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP |
eIF3B Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human eIF3B (NP_003742.2). |
Modifications | Unmodified |
eIF3B Rabbit monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
eIF3B Rabbit monoclonal Antibody
Applications | IF, IP, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |