Antibodies

View as table Download

EIF3B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human EIF3B

Rabbit Polyclonal Anti-EIF3S9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF3S9 antibody: synthetic peptide directed towards the C terminal of human EIF3S9. Synthetic peptide located within the following region: YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP

eIF3B Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human eIF3B (NP_003742.2).
Modifications Unmodified

eIF3B Rabbit monoclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

eIF3B Rabbit monoclonal Antibody

Applications IF, IP, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated