Rabbit Polyclonal Anti-FAP-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FAP-1 Antibody: A synthesized peptide derived from human FAP-1 |
Rabbit Polyclonal Anti-FAP-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FAP-1 Antibody: A synthesized peptide derived from human FAP-1 |
Rabbit polyclonal Fibroblast Activation Protein antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of mouse FAP protein. |
Rabbit Polyclonal Anti-FAP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FAP antibody is: synthetic peptide directed towards the C-terminal region of Human FAP. Synthetic peptide located within the following region: SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA |
Rabbit Polyclonal Anti-FAP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FAP |
FAP rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FAP |
Fibroblast activation protein-α (FAP) Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-280 of human fibroblast activation protein-α (Fibroblast activation protein-α (FAP)) (NP_004451.2). |
Modifications | Unmodified |