Antibodies

Jump to Filters
View as table Download
Pannexin 3 (PANX3) Rabbit Polyclonal Antibody
TA329534

USD 375.00

5 Days

Rabbit Polyclonal anti-PANX3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PANX3 antibody: synthetic peptide directed towards the middle region of human PANX3. Synthetic peptide located within the following region: IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL