Rabbit Polyclonal Anti-SELENBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SELENBP1 antibody: synthetic peptide directed towards the C terminal of human SELENBP1. Synthetic peptide located within the following region: KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR |
Rabbit Polyclonal Anti-SELENBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SELENBP1 antibody: synthetic peptide directed towards the N terminal of human SELENBP1. Synthetic peptide located within the following region: MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD |
SELENBP1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SELENBP1 |
Germany
Japan
United Kingdom
China
