Selenium Binding Protein 1 (SELENBP1) Rabbit Polyclonal Antibody

CAT#: TA346582

Rabbit Polyclonal Anti-SELENBP1 Antibody

Product Images

WB Suggested Anti-SELENBP1 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate

• 

  Host: Rabbit; Target Name: FAM46C; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: SERPINA3; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: NOP56; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml; SELENBP1 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Rabbit Anti-SELENBP1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue; Observed Staining: Cytoplasmic, membrane and nuclear in alveolar type I & II cells; Primary Antibody Concentration: 1: 100; Other Working Concentrations: 1/600; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1: 200; Magnification: 20X; Exposure Time: 0.5–2.0 sec;

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SELENBP1 antibody: synthetic peptide directed towards the C terminal of human SELENBP1. Synthetic peptide located within the following region: KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: selenium binding protein 1
• Database Link:
  NP_001245217
  Entrez Gene 8991 Human
  UniProt ID Q13228
• Background: This gene encodes a member of the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. The effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins, and decreased expression of this gene may be associated with several types of cancer. The encoded protein may play a selenium-dependent role in ubiquitination/deubiquitination-mediated protein degradation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2012]
• Synonyms: HEL-S-134P; hSBP; LPSB; SBP56; SP56
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 86%; Goat: 79%