Rabbit Polyclonal Anti-SERPINB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINB1 antibody: synthetic peptide directed towards the middle region of human SERPINB1. Synthetic peptide located within the following region: RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL |
SERPINB1 Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region (EVHSRFQSLNADINKR) |
SERPINB1 Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region (KTINQWVKGQTEGK) |
Rabbit Polyclonal Anti-SERPINB1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SERPINB1 |
SERPINB1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-379 of human SERPINB1 (NP_109591.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China