SERPINB1 Rabbit Polyclonal Antibody

CAT#: TA340203

Rabbit Polyclonal Anti-SERPINB1 Antibody

Product Images

WB Suggested Anti-SERPINB1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SERPINB1 antibody: synthetic peptide directed towards the middle region of human SERPINB1. Synthetic peptide located within the following region: RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: serpin family B member 1
• Database Link:
  NP_109591
  Entrez Gene 1992 Human
  UniProt ID P30740
• Background: SERPINB1 regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3.
• Synonyms: EI; ELANH2; HEL-S-27; HEL57; LEI; M; MNEI; NEI; PI-2; PI2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Mouse: 93%; Rat: 92%; Sheep: 86%; Bovine: 86%; Horse: 85%; Pig: 77%

Reference Data

• Protein Families: Druggable Genome