SGK3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Hamster, Human, Mouse, Orang-Utan, Rat |
| Immunogen | SGK3 antibody was raised against synthetic 20 amino acid peptide from internal region of human SGK3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Mouse, Rat, Hamster, Panda, Dog, Bat (100%); Monkey, Marmoset, Elephant, Bovine, Horse, Rabbit (95%); Turkey, Chicken, Platypus (90%); Opossum, Lizard (85%). |
Rabbit polyclonal Anti-SGK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-SGK3 antibody: synthetic peptide directed towards the N terminal of human SGK3. Synthetic peptide located within the following region: LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH |
SGK3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SGK3 (NP_037389.4). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
